All categories
Featured selections
Trade Assurance
Buyer Central
Help Center
Get the app
Become a supplier

Aps

(999+ productos disponibles)

Cubeta para Hielo de Acero Inoxidable APS de 1L y 14cm con Pinzas, Recipientes para Bebidas - Product Image 1
Cubeta para Hielo de Acero Inoxidable APS de 1L y 14cm con Pinzas, Recipientes para Bebidas - Product Image 2

Cubeta para Hielo de Acero Inoxidable APS de 1L y 14cm con Pinzas, Recipientes para Bebidas

EUR 30.68
MOQ: 1 unidad
Power and Handel Vertriebs GmbH
1 yrsDE flagDE
Chuangying Aluminum Alloy Angle APS-L8080W 8080W Industrial Profile Durable Connectors For Automated Equipment - Product Image 1
Chuangying Aluminum Alloy Angle APS-L8080W 8080W Industrial Profile Durable Connectors For Automated Equipment - Product Image 2
Chuangying Aluminum Alloy Angle APS-L8080W 8080W Industrial Profile Durable Connectors For Automated Equipment - Product Image 3
Chuangying Aluminum Alloy Angle APS-L8080W 8080W Industrial Profile Durable Connectors For Automated Equipment - Product Image 4
Chuangying Aluminum Alloy Angle APS-L8080W 8080W Industrial Profile Durable Connectors For Automated Equipment - Product Image 5

Chuangying Aluminum Alloy Angle APS-L8080W 8080W Industrial Profile Durable Connectors For Automated Equipment

EUR 4.66
MOQ: 2 unidades
ZZRS INDUSTRY LIMITED
1 yrsHK flagHK5.0/5.0(2)
Chint 25kW 3 Fase String Inverter 480Vac (APS RSD Wiringbox) -1/1/2 - Product Image 1

Chint 25kW 3 Fase String Inverter 480Vac (APS RSD Wiringbox) -1/1/2

EUR 2,834.29
MOQ: 2 unidades
Portlandia Electric Supply LLC
2 yrsUS flagUS
Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo - Product Image 1
Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo - Product Image 2
Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo - Product Image 3
Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo - Product Image 4
Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo - Product Image 5
Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo - Product Image 6

Enganche Trasero APS de 2 Pulgadas, Receptor Clase 3 para Honda Odyssey 1999-2017, Acero al Carbono con Recubrimiento en Polvo

EUR 109.24
MOQ: 2 unidades
Kangcheng International HK Co., Limited
1 yrsHK flagHK
APS 1/36 L Eisportionierer Herramienta para Helados - Product Image 1
APS 1/36 L Eisportionierer Herramienta para Helados - Product Image 2
APS 1/36 L Eisportionierer Herramienta para Helados - Product Image 3

APS 1/36 L Eisportionierer Herramienta para Helados

EUR 11.44
MOQ: 1 unidad
Power and Handel Vertriebs GmbH
1 yrsDE flagDE
Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo - Product Image 1
Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo - Product Image 2
Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo - Product Image 3
Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo - Product Image 4
Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo - Product Image 5
Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo - Product Image 6

Enganche Trasero APS de 2 Pulgadas con Receptor Clase 3 para Honda CR-V 2002-2006, Acero al Carbono con Recubrimiento en Polvo

EUR 114.07
MOQ: 2 unidades
Kangcheng International HK Co., Limited
1 yrsHK flagHK
Herramienta para Helados APS 1/16 L Eisportionierer - Product Image 1
Herramienta para Helados APS 1/16 L Eisportionierer - Product Image 2
Herramienta para Helados APS 1/16 L Eisportionierer - Product Image 3

Herramienta para Helados APS 1/16 L Eisportionierer

EUR 11.44
MOQ: 1 unidad
Power and Handel Vertriebs GmbH
1 yrsDE flagDE
Inversor de Cadena Trifásico Chint Power de 60kW, 3 MPPT, Caja de Conexiones RSD, 1000VDC, SCA60KTL-DO/US-APS, Fabricado en EE. UU. - Product Image 1

Inversor de Cadena Trifásico Chint Power de 60kW, 3 MPPT, Caja de Conexiones RSD, 1000VDC, SCA60KTL-DO/US-APS, Fabricado en EE. UU.

EUR 5,384.17
MOQ: 2 unidades
Portlandia Electric Supply LLC
2 yrsUS flagUS

Búsquedas relacionadas:

aeaaplapgapatipaatsetsapravsafsedselpipeseskassaimpsessesadesupaae